Lineage for d2haea1 (2hae A:155-376)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688318Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 688434Protein Malate oxidoreductase (malic enzyme) [110434] (1 species)
  7. 688435Species Thermotoga maritima [TaxId:2336] [110435] (2 PDB entries)
  8. 688440Domain d2haea1: 2hae A:155-376 [136278]
    Other proteins in same PDB: d2haea2, d2haeb2, d2haec2, d2haed2
    automatically matched to d1vl6a1
    complexed with nad, zn

Details for d2haea1

PDB Entry: 2hae (more details), 3.13 Å

PDB Description: crystal structure of a putative malic enzyme (malate oxidoreductase)
PDB Compounds: (A:) Malate oxidoreductase

SCOP Domain Sequences for d2haea1:

Sequence, based on SEQRES records: (download)

>d2haea1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyhleiaritnperlsgdletalegadffigvsrgnilkpewikkmsr
kpvifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitk
nmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa

Sequence, based on observed residues (ATOM records): (download)

>d2haea1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyeiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkp
vifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknm
llsaveaiarscepeperiipeafdmkvhlnvytavkgsa

SCOP Domain Coordinates for d2haea1:

Click to download the PDB-style file with coordinates for d2haea1.
(The format of our PDB-style files is described here.)

Timeline for d2haea1: