Lineage for d2h9rb1 (2h9r B:2-46)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322371Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2322372Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2322373Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2322381Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. 2322382Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries)
  8. 2322388Domain d2h9rb1: 2h9r B:2-46 [136269]
    Other proteins in same PDB: d2h9ra2, d2h9rb2
    automatically matched to d1l6ea_

Details for d2h9rb1

PDB Entry: 2h9r (more details)

PDB Description: docking and dimerization domain (d/d) of the regulatory subunit of the type ii-alpha camp-dependent protein kinase a associated with a peptide derived from an a-kinase anchoring protein (akap)
PDB Compounds: (B:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2h9rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9rb1 a.31.1.1 (B:2-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

SCOPe Domain Coordinates for d2h9rb1:

Click to download the PDB-style file with coordinates for d2h9rb1.
(The format of our PDB-style files is described here.)

Timeline for d2h9rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h9rb2