Lineage for d2h9rb1 (2h9r B:2-46)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries)
  8. Domain d2h9rb1: 2h9r B:2-46 [136269]
    Other proteins in same PDB: d2h9ra2, d2h9rb2
    automatically matched to d1l6ea_

Details for d2h9rb1

PDB Entry: 2h9r (more details)

PDB Description: Docking and dimerization domain (D/D) of the regulatory subunit of the Type II-alpha cAMP-dependent protein kinase A associated with a Peptide derived from an A-kinase anchoring protein (AKAP)
PDB Compounds: (B:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2h9rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9rb1 a.31.1.1 (B:2-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

SCOPe Domain Coordinates for d2h9rb1 are not available.

Timeline for d2h9rb1:

Domains from same chain:
(mouse over for more information)
d2h9rb2
Domains from other chains:
(mouse over for more information)
d2h9ra1, d2h9ra2