SCOPe 2.07: Domain d2h9ra1: 2h9r A:2-46

Lineage for d2h9ra1 (2h9r A:2-46)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries)

8. Domain d2h9ra1: 2h9r A:2-46 [136268]
   Other proteins in same PDB: d2h9ra2, d2h9rb2
   automatically matched to d1l6ea_

Details for d2h9ra1

PDB Entry: 2h9r

PDB Description: docking and dimerization domain (d/d) of the regulatory subunit of the type ii-alpha camp-dependent protein kinase a associated with a peptide derived from an a-kinase anchoring protein (akap)

PDB Compounds: (A:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2h9ra1:

Sequence; same for both SEQRES and ATOM records:

>d2h9ra1 a.31.1.1 (A:2-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

Timeline for d2h9ra1:

• d2h9ra1 first appeared in SCOP 1.73
  
• d2h9ra1 appears in SCOPe 2.06
  
• d2h9ra1 appears in the current release, SCOPe 2.08