Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
Species Human hepatitis A virus [TaxId:208726] [50606] (5 PDB entries) |
Domain d2h9ha_: 2h9h A: [136264] automated match to d1hava_ complexed with bbl |
PDB Entry: 2h9h (more details), 1.39 Å
SCOPe Domain Sequences for d2h9ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9ha_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn qsiqnailgihvaggnsilvaklvtqemfqni
Timeline for d2h9ha_: