| Class g: Small proteins [56992] (85 folds) |
| Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (2 families) ![]() |
| Family g.24.1.1: TNF receptor-like [57587] (5 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
| Protein Death receptor-5 (dr5) fragment [57590] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries) |
| Domain d2h9gr1: 2h9g R:21-61 [136261] Other proteins in same PDB: d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2 automatically matched to d1d0gr1 |
PDB Entry: 2h9g (more details), 2.32 Å
SCOP Domain Sequences for d2h9gr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9gr1 g.24.1.1 (R:21-61) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]}
sspseglcppghhisedgrdcisckygqdysthwndllfcl
Timeline for d2h9gr1:
View in 3DDomains from other chains: (mouse over for more information) d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2 |