SCOPe 2.02: Domain d2h9gh2: 2h9g H:114-213

Lineage for d2h9gh2 (2h9g H:114-213)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

Domain d2h9gh2: 2h9g H:114-213 [136260]
Other proteins in same PDB: d2h9gb1, d2h9gh1, d2h9gr1, d2h9gr2, d2h9gr3
automatically matched to d1ngzb2

Details for d2h9gh2

PDB Entry: 2h9g (more details), 2.32 Å

PDB Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)

PDB Compounds: (H:) Fab BdF1, heavy chain

SCOPe Domain Sequences for d2h9gh2:

Sequence, based on SEQRES records: (download)

>d2h9gh2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d2h9gh2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d2h9gh2:

Click to download the PDB-style file with coordinates for d2h9gh2.
(The format of our PDB-style files is described here.)

Timeline for d2h9gh2: