Lineage for d2h9gh1 (2h9g H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652161Species Engineered (including hybrid species) [88562] (66 PDB entries)
  8. 652205Domain d2h9gh1: 2h9g H:1-113 [136259]
    Other proteins in same PDB: d2h9gb2, d2h9gh2, d2h9gr1, d2h9gr2, d2h9gr3
    automatically matched to d1fvcb_

Details for d2h9gh1

PDB Entry: 2h9g (more details), 2.32 Å

PDB Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)
PDB Compounds: (H:) Fab BdF1, heavy chain

SCOP Domain Sequences for d2h9gh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9gh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfsigksgihwvrqapgkglewvaviyphdgntay
adsvkgrftisadtskntaylqmnslraedtavyycarrlalvrmwmdywgqgtlvtvss

SCOP Domain Coordinates for d2h9gh1:

Click to download the PDB-style file with coordinates for d2h9gh1.
(The format of our PDB-style files is described here.)

Timeline for d2h9gh1: