Lineage for d2h9gb1 (2h9g B:1-113)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929502Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 929545Domain d2h9gb1: 2h9g B:1-113 [136257]
    Other proteins in same PDB: d2h9gb2, d2h9gh2, d2h9gr1, d2h9gr2, d2h9gr3
    automatically matched to d1fvcb_

Details for d2h9gb1

PDB Entry: 2h9g (more details), 2.32 Å

PDB Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)
PDB Compounds: (B:) Fab BdF1, heavy chain

SCOPe Domain Sequences for d2h9gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9gb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfsigksgihwvrqapgkglewvaviyphdgntay
adsvkgrftisadtskntaylqmnslraedtavyycarrlalvrmwmdywgqgtlvtvss

SCOPe Domain Coordinates for d2h9gb1:

Click to download the PDB-style file with coordinates for d2h9gb1.
(The format of our PDB-style files is described here.)

Timeline for d2h9gb1: