![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Engineered (including hybrid species) [88562] (67 PDB entries) SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody |
![]() | Domain d2h9gb1: 2h9g B:1-113 [136257] Other proteins in same PDB: d2h9ga1, d2h9ga2, d2h9gb2, d2h9gh2, d2h9gl1, d2h9gl2, d2h9gr1, d2h9gr2, d2h9gr3, d2h9gs1 automatically matched to d1fvcb_ |
PDB Entry: 2h9g (more details), 2.32 Å
SCOPe Domain Sequences for d2h9gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9gb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} evqlvesggglvqpggslrlscaasgfsigksgihwvrqapgkglewvaviyphdgntay adsvkgrftisadtskntaylqmnslraedtavyycarrlalvrmwmdywgqgtlvtvss
Timeline for d2h9gb1: