SCOPe 2.07: Domain d2h9ec_: 2h9e C:

Lineage for d2h9ec_ (2h9e C:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.22: Serine protease inhibitors [57566] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.22.1: Serine protease inhibitors [57567] (2 families)

5. Family g.22.1.1: ATI-like [57568] (5 proteins)
   automatically mapped to Pfam PF01826

6. Protein automated matches [190313] (1 species)
   not a true protein

7. Species Dog hookworm (Ancylostoma caninum) [TaxId:29170] [187127] (1 PDB entry)

8. Domain d2h9ec_: 2h9e C: [136254]
   Other proteins in same PDB: d2h9eh_, d2h9el1
   automated match to d1coua_
   complexed with act, na, po4

Details for d2h9ec_

PDB Entry: 2h9e, 2.2 Å

PDB Description: crystal structure of fxa/selectide/napc2 ternary complex

PDB Compounds: (C:) Anti-coagulant protein C2

SCOPe Domain Sequences for d2h9ec_:

Sequence, based on SEQRES records:

>d2h9ec_ g.22.1.1 (C:) automated matches {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]}
cgenekydscgskecdkkckydgveeeddeepnvpclvrvchqdcvceegfyrnkddkcv
saedceldnmdfiypgtr

Sequence, based on observed residues (ATOM records):

>d2h9ec_ g.22.1.1 (C:) automated matches {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]}
cgenekyddkkckydgvecvceegfyrnkddkcvsaedceldnmdfiypgtr

Timeline for d2h9ec_:

• d2h9ec_ first appeared in SCOP 1.73, called d2h9ec1
  
• d2h9ec_ appears in SCOPe 2.06
  
• d2h9ec_ appears in the current release, SCOPe 2.08