Lineage for d2h9ec1 (2h9e C:6-83)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749592Fold g.22: Serine protease inhibitors [57566] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 749593Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) (S)
  5. 749594Family g.22.1.1: ATI-like [57568] (4 proteins)
  6. 749595Protein Anticoagulant protein [57573] (1 species)
  7. 749596Species Dog hookworm (Ancylostoma caninum) [TaxId:29170] [57574] (2 PDB entries)
  8. 749597Domain d2h9ec1: 2h9e C:6-83 [136254]
    Other proteins in same PDB: d2h9eh1, d2h9el1
    automatically matched to d1coua_
    complexed with act, lpd, na, po4

Details for d2h9ec1

PDB Entry: 2h9e (more details), 2.2 Å

PDB Description: crystal structure of fxa/selectide/napc2 ternary complex
PDB Compounds: (C:) Anti-coagulant protein C2

SCOP Domain Sequences for d2h9ec1:

Sequence, based on SEQRES records: (download)

>d2h9ec1 g.22.1.1 (C:6-83) Anticoagulant protein {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]}
cgenekydscgskecdkkckydgveeeddeepnvpclvrvchqdcvceegfyrnkddkcv
saedceldnmdfiypgtr

Sequence, based on observed residues (ATOM records): (download)

>d2h9ec1 g.22.1.1 (C:6-83) Anticoagulant protein {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]}
cgenekyddkkckydgvecvceegfyrnkddkcvsaedceldnmdfiypgtr

SCOP Domain Coordinates for d2h9ec1:

Click to download the PDB-style file with coordinates for d2h9ec1.
(The format of our PDB-style files is described here.)

Timeline for d2h9ec1: