Lineage for d2h9dd1 (2h9d D:1-94)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648923Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 648924Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 648925Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
    intertwined homodimer of 3-helical subunits
  6. 648937Protein Salicylate biosynthesis protein PchB [140938] (1 species)
  7. 648938Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
  8. 648942Domain d2h9dd1: 2h9d D:1-94 [136253]
    automatically matched to 2H9D A:1-94
    complexed with ca, pyr

Details for d2h9dd1

PDB Entry: 2h9d (more details), 1.95 Å

PDB Description: pyruvate-bound structure of the isochorismate-pyruvate lyase from pseudomonas aerugionsa
PDB Compounds: (D:) Salicylate biosynthesis protein pchB

SCOP Domain Sequences for d2h9dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9dd1 a.130.1.1 (D:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikyw

SCOP Domain Coordinates for d2h9dd1:

Click to download the PDB-style file with coordinates for d2h9dd1.
(The format of our PDB-style files is described here.)

Timeline for d2h9dd1: