SCOPe 2.07: Domain d2h9da1: 2h9d A:1-94

Lineage for d2h9da1 (2h9d A:1-94)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein Salicylate biosynthesis protein PchB [140938] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
   Uniprot Q51507 1-94

8. Domain d2h9da1: 2h9d A:1-94 [136250]
   complexed with ca, pyr

Details for d2h9da1

PDB Entry: 2h9d, 1.95 Å

PDB Description: pyruvate-bound structure of the isochorismate-pyruvate lyase from pseudomonas aerugionsa

PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d2h9da1:

Sequence, based on SEQRES records:

>d2h9da1 a.130.1.1 (A:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikyw

Sequence, based on observed residues (ATOM records):

>d2h9da1 a.130.1.1 (A:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfervaamlperarwaeengl
dapfveglfaqiihwyiaeqikyw

Timeline for d2h9da1:

• d2h9da1 first appeared in SCOP 1.73
  
• d2h9da1 appears in SCOPe 2.06
  
• d2h9da1 appears in the current release, SCOPe 2.08