Lineage for d2h9cb1 (2h9c B:1-92)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777702Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 777703Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 777704Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
    intertwined homodimer of 3-helical subunits
  6. 777716Protein Salicylate biosynthesis protein PchB [140938] (1 species)
  7. 777717Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
    Uniprot Q51507 1-94
  8. 777723Domain d2h9cb1: 2h9c B:1-92 [136249]
    automatically matched to 2H9D A:1-94
    complexed with no3

Details for d2h9cb1

PDB Entry: 2h9c (more details), 2.35 Å

PDB Description: native crystal structure of the isochorismate-pyruvate lyase from pseudomonas aeruginosa
PDB Compounds: (B:) Salicylate biosynthesis protein pchB

SCOP Domain Sequences for d2h9cb1:

Sequence, based on SEQRES records: (download)

>d2h9cb1 a.130.1.1 (B:1-92) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqik

Sequence, based on observed residues (ATOM records): (download)

>d2h9cb1 a.130.1.1 (B:1-92) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfpapervaamlperarwaee
ngldapfveglfaqiihwyiaeqik

SCOP Domain Coordinates for d2h9cb1:

Click to download the PDB-style file with coordinates for d2h9cb1.
(The format of our PDB-style files is described here.)

Timeline for d2h9cb1: