Lineage for d2h9ca1 (2h9c A:1-94)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.130: Chorismate mutase II [48599] (1 superfamily)
multihelical; core: 6 helices, bundleSuperfamily a.130.1: Chorismate mutase II [48600] (4 families) 
Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
intertwined homodimer of 3-helical subunits
Protein Salicylate biosynthesis protein PchB [140938] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
Uniprot Q51507 1-94
Domain d2h9ca1: 2h9c A:1-94 [136248]
automatically matched to 2H9D A:1-94
complexed with no3
Details for d2h9ca1
PDB Entry: 2h9c (more details), 2.35 Å
PDB Description: native crystal structure of the isochorismate-pyruvate lyase from pseudomonas aeruginosa
PDB Compounds: (A:) Salicylate biosynthesis protein pchBSCOP Domain Sequences for d2h9ca1:
Sequence, based on SEQRES records: (download)
>d2h9ca1 a.130.1.1 (A:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikyw
Sequence, based on observed residues (ATOM records): (download)
>d2h9ca1 a.130.1.1 (A:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfapervaamlperarwaeen
gldapfveglfaqiihwyiaeqikyw
SCOP Domain Coordinates for d2h9ca1:
Click to download the PDB-style file with coordinates for d2h9ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h9ca1:
- d2h9ca1 first appeared in SCOP 1.73
- d2h9ca1 is called d2h9ca_ in SCOPe 2.01
- d2h9ca1 appears in the current release, SCOPe 2.08, called d2h9ca_
View in 3D
