SCOP 1.75: Domain d2h9ca1: 2h9c A:1-94

Lineage for d2h9ca1 (2h9c A:1-94)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein Salicylate biosynthesis protein PchB [140938] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
   Uniprot Q51507 1-94

8. Domain d2h9ca1: 2h9c A:1-94 [136248]
   automatically matched to 2H9D A:1-94
   complexed with no3

Details for d2h9ca1

PDB Entry: 2h9c, 2.35 Å

PDB Description: native crystal structure of the isochorismate-pyruvate lyase from pseudomonas aeruginosa

PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOP Domain Sequences for d2h9ca1:

Sequence, based on SEQRES records:

>d2h9ca1 a.130.1.1 (A:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikyw

Sequence, based on observed residues (ATOM records):

>d2h9ca1 a.130.1.1 (A:1-94) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfapervaamlperarwaeen
gldapfveglfaqiihwyiaeqikyw

Timeline for d2h9ca1:

• d2h9ca1 first appeared in SCOP 1.73
  
• d2h9ca1 is called d2h9ca_ in SCOPe 2.01
  
• d2h9ca1 appears in the current release, SCOPe 2.08, called d2h9ca_