Lineage for d2h9ca_ (2h9c A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. Protein Salicylate biosynthesis protein PchB [140938] (1 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
    Uniprot Q51507 1-94
  8. Domain d2h9ca_: 2h9c A: [136248]
    automated match to d2h9ca1
    complexed with no3

Details for d2h9ca_

PDB Entry: 2h9c (more details), 2.3499999999999996 Å

PDB Description: native crystal structure of the isochorismate-pyruvate lyase from pseudomonas aeruginosa
PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d2h9ca_:

Sequence, based on SEQRES records: (download)

>d2h9ca_ a.130.1.1 (A:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrq

Sequence, based on observed residues (ATOM records): (download)

>d2h9ca_ a.130.1.1 (A:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfapervaamlperarwaeen
gldapfveglfaqiihwyiaeqikywrq

SCOPe Domain Coordinates for d2h9ca_ are not available.

Timeline for d2h9ca_:

Domains from other chains:
(mouse over for more information)
d2h9cb_