![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein Bucain [111404] (1 species) |
![]() | Species Malayan krait (Bungarus candidus) [TaxId:92438] [111405] (2 PDB entries) Uniprot P83346 |
![]() | Domain d2h8ub_: 2h8u B: [136247] automated match to d1vyca_ |
PDB Entry: 2h8u (more details), 2.1 Å
SCOPe Domain Sequences for d2h8ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8ub_ g.7.1.1 (B:) Bucain {Malayan krait (Bungarus candidus) [TaxId: 92438]} rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak dkcna
Timeline for d2h8ub_: