SCOPe 2.08: Domain d2h8ub_: 2h8u B:

Lineage for d2h8ub_ (2h8u B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Bucain [111404] (1 species)

7. Species Malayan krait (Bungarus candidus) [TaxId:92438] [111405] (2 PDB entries)
   Uniprot P83346

8. Domain d2h8ub_: 2h8u B: [136247]
   automated match to d1vyca_

Details for d2h8ub_

PDB Entry: 2h8u, 2.1 Å

PDB Description: bucain, a cardiotoxin from the malayan krait bungarus candidus

PDB Compounds: (B:) Bucain

SCOPe Domain Sequences for d2h8ub_:

Sequence; same for both SEQRES and ATOM records:

>d2h8ub_ g.7.1.1 (B:) Bucain {Malayan krait (Bungarus candidus) [TaxId: 92438]}
rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak
dkcna

Timeline for d2h8ub_:

• d2h8ub_ first appeared in SCOP 1.73, called d2h8ub1
  
• d2h8ub_ appears in SCOPe 2.07