Lineage for d2h8ua1 (2h8u A:1-65)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748275Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 748276Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 748277Family g.7.1.1: Snake venom toxins [57303] (27 proteins)
  6. 748296Protein Bucain [111404] (1 species)
  7. 748297Species Malaysian krait (Bungarus candidus) [TaxId:92438] [111405] (2 PDB entries)
  8. 748298Domain d2h8ua1: 2h8u A:1-65 [136246]
    automatically matched to d1vyca_

Details for d2h8ua1

PDB Entry: 2h8u (more details), 2.1 Å

PDB Description: bucain, a cardiotoxin from the malayan krait bungarus candidus
PDB Compounds: (A:) Bucain

SCOP Domain Sequences for d2h8ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8ua1 g.7.1.1 (A:1-65) Bucain {Malaysian krait (Bungarus candidus) [TaxId: 92438]}
rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak
dkcna

SCOP Domain Coordinates for d2h8ua1:

Click to download the PDB-style file with coordinates for d2h8ua1.
(The format of our PDB-style files is described here.)

Timeline for d2h8ua1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h8ub1