Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins) |
Protein Potassium channel protein [56901] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 |
Domain d2h8pd1: 2h8p D:86-119 [136245] automatically matched to d1jq1a_ complexed with b3h, goa, k |
PDB Entry: 2h8p (more details), 2.25 Å
SCOP Domain Sequences for d2h8pd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8pd1 f.14.1.1 (D:86-119) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} lwgrlvavvvmvagitsfglvtaalatwfvgreq
Timeline for d2h8pd1: