SCOP 1.73: Domain d2h8fd1: 2h8f D:1-146

Lineage for d2h8fd1 (2h8f D:1-146)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (22 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (6 PDB entries)

8. Domain d2h8fd1: 2h8f D:1-146 [136242]
   Other proteins in same PDB: d2h8fa1, d2h8fc1
   automatically matched to d1hbhb_
   complexed with ace, hem

Details for d2h8fd1

PDB Entry: 2h8f, 1.3 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 6.2

PDB Compounds: (D:) Hemoglobin beta subunit

SCOP Domain Sequences for d2h8fd1:

Sequence; same for both SEQRES and ATOM records:

>d2h8fd1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d2h8fd1:

• d2h8fd1 is new in SCOP 1.73
  
• d2h8fd1 appears in SCOP 1.75
  
• d2h8fd1 appears in the current release, SCOPe 2.08, called d2h8fd_