Lineage for d2h8fc1 (2h8f C:1-142)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 631898Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (6 PDB entries)
  8. 631900Domain d2h8fc1: 2h8f C:1-142 [136241]
    Other proteins in same PDB: d2h8fb1, d2h8fd1
    automatically matched to d1hbha_
    complexed with ace, hem

Details for d2h8fc1

PDB Entry: 2h8f (more details), 1.3 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 6.2
PDB Compounds: (C:) Hemoglobin alpha subunit

SCOP Domain Sequences for d2h8fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8fc1 a.1.1.2 (C:1-142) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d2h8fc1:

Click to download the PDB-style file with coordinates for d2h8fc1.
(The format of our PDB-style files is described here.)

Timeline for d2h8fc1: