Lineage for d2h8fa_ (2h8f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686315Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries)
  8. 2686316Domain d2h8fa_: 2h8f A: [136239]
    Other proteins in same PDB: d2h8fb_, d2h8fd_
    automated match to d1hbha_
    complexed with hem

Details for d2h8fa_

PDB Entry: 2h8f (more details), 1.3 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 6.2
PDB Compounds: (A:) Hemoglobin alpha subunit

SCOPe Domain Sequences for d2h8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d2h8fa_:

Click to download the PDB-style file with coordinates for d2h8fa_.
(The format of our PDB-style files is described here.)

Timeline for d2h8fa_: