SCOPe 2.07: Domain d2h85a2: 2h85 A:191-345

Lineage for d2h85a2 (2h85 A:191-345)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
   PfamB PB001946

6. Protein Nsp15, C-terminal domain [142882] (2 species)

7. Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries)
   Uniprot Q6VA80 6620-6774

8. Domain d2h85a2: 2h85 A:191-345 [136234]
   Other proteins in same PDB: d2h85a1, d2h85a3

Details for d2h85a2

PDB Entry: 2h85, 2.6 Å

PDB Description: crystal structure of nsp 15 from sars

PDB Compounds: (A:) Putative orf1ab polyprotein

SCOPe Domain Sequences for d2h85a2:

Sequence; same for both SEQRES and ATOM records:

>d2h85a2 d.294.1.2 (A:191-345) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygdfshgqlgglhl
miglakrsqdsplkledfipmdstvknyfitdaqtgsskcgcsvidlllgdfveiiksqd
lsviskvvkvtidyaeisfmlwckdghvetfypkl

Timeline for d2h85a2:

• d2h85a2 first appeared in SCOP 1.73
  
• d2h85a2 appears in SCOPe 2.06
  
• d2h85a2 appears in the current release, SCOPe 2.08