Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (1 protein) rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain |
Protein Nsp15 [142626] (2 species) |
Species SARS coronavirus [TaxId:227859] [142628] (3 PDB entries) Uniprot Q6VA80 6619-6774 |
Domain d2h85a1: 2h85 A:0-190 [136233] Other proteins in same PDB: d2h85a2, d2h85a3 |
PDB Entry: 2h85 (more details), 2.6 Å
SCOPe Domain Sequences for d2h85a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h85a1 c.66.1.48 (A:0-190) Nsp15 {SARS coronavirus [TaxId: 227859]} qslenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelwa krnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacssl tvlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfnyf kkvdgiiqqlp
Timeline for d2h85a1: