Lineage for d2h85a1 (2h85 A:1-190)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865561Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (1 protein)
    rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain
  6. 1865562Protein Nsp15 [142626] (2 species)
  7. 1865566Species SARS coronavirus [TaxId:227859] [142628] (3 PDB entries)
    Uniprot Q6VA80 6619-6774
  8. 1865567Domain d2h85a1: 2h85 A:1-190 [136233]
    Other proteins in same PDB: d2h85a2

Details for d2h85a1

PDB Entry: 2h85 (more details), 2.6 Å

PDB Description: crystal structure of nsp 15 from sars
PDB Compounds: (A:) Putative orf1ab polyprotein

SCOPe Domain Sequences for d2h85a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h85a1 c.66.1.48 (A:1-190) Nsp15 {SARS coronavirus [TaxId: 227859]}
slenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelwak
rnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacsslt
vlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfnyfk
kvdgiiqqlp

SCOPe Domain Coordinates for d2h85a1:

Click to download the PDB-style file with coordinates for d2h85a1.
(The format of our PDB-style files is described here.)

Timeline for d2h85a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h85a2