![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein Irditoxin subunit B [144105] (1 species) |
![]() | Species Brown tree snake (Boiga irregularis) [TaxId:92519] [144106] (1 PDB entry) Uniprot A0S865 35-111 |
![]() | Domain d2h7zb1: 2h7z B:1-77 [136232] Other proteins in same PDB: d2h7za1 |
PDB Entry: 2h7z (more details), 1.5 Å
SCOPe Domain Sequences for d2h7zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h7zb1 g.7.1.1 (B:1-77) Irditoxin subunit B {Brown tree snake (Boiga irregularis) [TaxId: 92519]} qakgppytlcfecnretcsncfkdnrcppyhrtcytlyrpdgngemkwavkgcaktcpta qpgesvqccntpkcndy
Timeline for d2h7zb1: