Lineage for d2h7zb1 (2h7z B:1-77)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032300Protein Irditoxin subunit B [144105] (1 species)
  7. 3032301Species Brown tree snake (Boiga irregularis) [TaxId:92519] [144106] (1 PDB entry)
    Uniprot A0S865 35-111
  8. 3032302Domain d2h7zb1: 2h7z B:1-77 [136232]
    Other proteins in same PDB: d2h7za1

Details for d2h7zb1

PDB Entry: 2h7z (more details), 1.5 Å

PDB Description: Crystal structure of irditoxin
PDB Compounds: (B:) Irditoxin subunit B

SCOPe Domain Sequences for d2h7zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h7zb1 g.7.1.1 (B:1-77) Irditoxin subunit B {Brown tree snake (Boiga irregularis) [TaxId: 92519]}
qakgppytlcfecnretcsncfkdnrcppyhrtcytlyrpdgngemkwavkgcaktcpta
qpgesvqccntpkcndy

SCOPe Domain Coordinates for d2h7zb1:

Click to download the PDB-style file with coordinates for d2h7zb1.
(The format of our PDB-style files is described here.)

Timeline for d2h7zb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h7za1