SCOPe 2.07: Domain d2h7za1: 2h7z A:1-75

Lineage for d2h7za1 (2h7z A:1-75)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Irditoxin subunit A [144103] (1 species)

7. Species Brown tree snake (Boiga irregularis) [TaxId:92519] [144104] (1 PDB entry)
   Uniprot A0S864 35-109

8. Domain d2h7za1: 2h7z A:1-75 [136231]
   Other proteins in same PDB: d2h7zb1

Details for d2h7za1

PDB Entry: 2h7z, 1.5 Å

PDB Description: Crystal structure of irditoxin

PDB Compounds: (A:) Irditoxin subunit A

SCOPe Domain Sequences for d2h7za1:

Sequence; same for both SEQRES and ATOM records:

>d2h7za1 g.7.1.1 (A:1-75) Irditoxin subunit A {Brown tree snake (Boiga irregularis) [TaxId: 92519]}
qavgppytlcfecnrmtssdcstalrcyrgscytlyrpdencelkwavkgcaetcptagp
nervkccrsprcndd

Timeline for d2h7za1:

• d2h7za1 first appeared in SCOP 1.73
  
• d2h7za1 appears in SCOPe 2.06
  
• d2h7za1 appears in the current release, SCOPe 2.08