Lineage for d2h7ya_ (2h7y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135525Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 protein domains)
    Pfam PF00975
  6. 2135539Protein Picromycin polyketide synthase [82513] (1 species)
  7. 2135540Species Streptomyces venezuelae [TaxId:54571] [82514] (7 PDB entries)
  8. 2135549Domain d2h7ya_: 2h7y A: [136229]
    automated match to d1mnab_
    complexed with dms, mg, psk, so4

Details for d2h7ya_

PDB Entry: 2h7y (more details), 2.1 Å

PDB Description: Pikromycin Thioesterase with covalent affinity label
PDB Compounds: (A:) Type I polyketide synthase PikAIV

SCOPe Domain Sequences for d2h7ya_:

Sequence, based on SEQRES records: (download)

>d2h7ya_ c.69.1.22 (A:) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}
agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdraegr
avlvgctgtaanggpheflrlstsfqeerdflavplpgygtgtgtgtallpadldtalda
qarailraagdapvvllghsggallahelafrlerahgappagivlvdpyppghqepiev
wsrqlgeglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeer
gdwrahwdlphtvadvpgdhftmmrdhapavaeavlswldaieg

Sequence, based on observed residues (ATOM records): (download)

>d2h7ya_ c.69.1.22 (A:) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}
agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdaegra
vlvgctgtaanggpheflrlstsfqeerdflavplpgygtggtallpadldtaldaqara
ilraagdapvvllghsggallahelafrlerahgappagivlvdpyppghqepievwsrq
lgeglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeergdwr
ahwdlphtvadvpgdhftmmrdhapavaeavlswldaieg

SCOPe Domain Coordinates for d2h7ya_:

Click to download the PDB-style file with coordinates for d2h7ya_.
(The format of our PDB-style files is described here.)

Timeline for d2h7ya_: