Lineage for d2h7wb1 (2h7w B:3-109)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 659292Superfamily b.1.26: ICP-like [141066] (1 family) (S)
    topological variant with similarity to the Cupredoxin-like fold (scop_cf 49502) in the N-terminal region
  5. 659293Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB 014070
  6. 659294Protein Chagasin [141068] (1 species)
  7. 659295Species Trypanosoma cruzi [TaxId:5693] [141069] (2 PDB entries)
  8. 659297Domain d2h7wb1: 2h7w B:3-109 [136226]
    automatically matched to 2H7W A:3-110

Details for d2h7wb1

PDB Entry: 2h7w (more details), 1.7 Å

PDB Description: crystal structure of chagasin, the endogenous cysteine-protease inhibitor from trypanosoma cruzi
PDB Compounds: (B:) Chagasin

SCOP Domain Sequences for d2h7wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h7wb1 b.1.26.1 (B:3-109) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
hkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppds
kllgaggtehfhvtvkaagthavnltymrpwtgpshdserfivylka

SCOP Domain Coordinates for d2h7wb1:

Click to download the PDB-style file with coordinates for d2h7wb1.
(The format of our PDB-style files is described here.)

Timeline for d2h7wb1: