Lineage for d2h7wa1 (2h7w A:3-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766737Superfamily b.1.26: ICP-like [141066] (2 families) (S)
    topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region
  5. 2766738Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB PB014070
    automatically mapped to Pfam PF09394
  6. 2766739Protein Chagasin [141068] (1 species)
  7. 2766740Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries)
    Uniprot Q966X9 3-110
  8. 2766745Domain d2h7wa1: 2h7w A:3-110 [136225]

Details for d2h7wa1

PDB Entry: 2h7w (more details), 1.7 Å

PDB Description: crystal structure of chagasin, the endogenous cysteine-protease inhibitor from trypanosoma cruzi
PDB Compounds: (A:) Chagasin

SCOPe Domain Sequences for d2h7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h7wa1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
hkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppds
kllgaggtehfhvtvkaagthavnltymrpwtgpshdserfivylkan

SCOPe Domain Coordinates for d2h7wa1:

Click to download the PDB-style file with coordinates for d2h7wa1.
(The format of our PDB-style files is described here.)

Timeline for d2h7wa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h7wb_