SCOPe 2.08: Domain d2h7wa1: 2h7w A:3-110

Lineage for d2h7wa1 (2h7w A:3-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.26: ICP-like [141066] (2 families)
   topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region

5. Family b.1.26.1: ICP-like [141067] (2 proteins)
   PfamB PB014070
   automatically mapped to Pfam PF09394

6. Protein Chagasin [141068] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries)
   Uniprot Q966X9 3-110

8. Domain d2h7wa1: 2h7w A:3-110 [136225]

Details for d2h7wa1

PDB Entry: 2h7w, 1.7 Å

PDB Description: crystal structure of chagasin, the endogenous cysteine-protease inhibitor from trypanosoma cruzi

PDB Compounds: (A:) Chagasin

SCOPe Domain Sequences for d2h7wa1:

Sequence; same for both SEQRES and ATOM records:

>d2h7wa1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
hkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppds
kllgaggtehfhvtvkaagthavnltymrpwtgpshdserfivylkan

Timeline for d2h7wa1:

• d2h7wa1 first appeared in SCOP 1.73
  
• d2h7wa1 appears in SCOPe 2.07