Lineage for d2h7vb_ (2h7v B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868484Domain d2h7vb_: 2h7v B: [136224]
    automated match to d1hh4a_
    complexed with gdp, mg

Details for d2h7vb_

PDB Entry: 2h7v (more details), 2.6 Å

PDB Description: co-crystal structure of ypka-rac1
PDB Compounds: (B:) Migration-inducing protein 5

SCOPe Domain Sequences for d2h7vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h7vb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsklmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
dtagqedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtk
ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
lcp

SCOPe Domain Coordinates for d2h7vb_:

Click to download the PDB-style file with coordinates for d2h7vb_.
(The format of our PDB-style files is described here.)

Timeline for d2h7vb_: