SCOPe 2.08: Domain d2h7jb_: 2h7j B:

Lineage for d2h7jb_ (2h7j B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d2h7jb_: 2h7j B: [136217]
   automated match to d1ms6a_
   complexed with h7j, p15

Details for d2h7jb_

PDB Entry: 2h7j, 1.5 Å

PDB Description: Crystal Structure of Cathepsin S in complex with a Nonpeptidic Inhibitor.

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d2h7jb_:

Sequence; same for both SEQRES and ATOM records:

>d2h7jb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2h7jb_:

• d2h7jb_ first appeared in SCOP 1.73, called d2h7jb1
  
• d2h7jb_ appears in SCOPe 2.07