Lineage for d2h7ja_ (2h7j A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1888976Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1889068Protein (Pro)cathepsin S [82566] (1 species)
  7. 1889069Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries)
  8. 1889070Domain d2h7ja_: 2h7j A: [136216]
    automated match to d1ms6a_
    complexed with h7j, p15

Details for d2h7ja_

PDB Entry: 2h7j (more details), 1.5 Å

PDB Description: Crystal Structure of Cathepsin S in complex with a Nonpeptidic Inhibitor.
PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d2h7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h7ja_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
wlvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOPe Domain Coordinates for d2h7ja_:

Click to download the PDB-style file with coordinates for d2h7ja_.
(The format of our PDB-style files is described here.)

Timeline for d2h7ja_: