SCOP 1.73: Domain d2h7ja1: 2h7j A:1-217

Lineage for d2h7ja1 (2h7j A:1-217)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (17 PDB entries)

8. Domain d2h7ja1: 2h7j A:1-217 [136216]
   automatically matched to d1ms6a_
   complexed with h7j, p15

Details for d2h7ja1

PDB Entry: 2h7j, 1.5 Å

PDB Description: Crystal Structure of Cathepsin S in complex with a Nonpeptidic Inhibitor.

PDB Compounds: (A:) cathepsin S

SCOP Domain Sequences for d2h7ja1:

Sequence; same for both SEQRES and ATOM records:

>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2h7ja1:

• d2h7ja1 is new in SCOP 1.73
  
• d2h7ja1 appears in SCOP 1.75
  
• d2h7ja1 appears in the current release, SCOPe 2.08, called d2h7ja_