SCOPe 2.01: Domain d2h7cb_: 2h7c B:

Lineage for d2h7cb_ (2h7c B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)

6. Protein automated matches [190065] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186857] (24 PDB entries)

8. Domain d2h7cb_: 2h7c B: [136208]
   automated match to d1k4ya_
   complexed with coa, nag, ndg, sia, so4

Details for d2h7cb_

PDB Entry: 2h7c, 2 Å

PDB Description: crystal structure of human carboxylesterase in complex with coenzyme a

PDB Compounds: (B:) Liver carboxylesterase 1

SCOPe Domain Sequences for d2h7cb_:

Sequence; same for both SEQRES and ATOM records:

>d2h7cb_ c.69.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknat
syppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihg
gglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwv
qdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdv
kplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgt
vidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsll
wksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdaga
ptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwan
farngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

Timeline for d2h7cb_:

• d2h7cb_ first appeared in SCOP 1.73, called d2h7cb1
  
• d2h7cb_ was called d2h7cb1 in SCOP 1.75
  
• d2h7cb_ appears in SCOPe 2.02
  
• d2h7cb_ appears in the current release, SCOPe 2.08