Lineage for d2h6pa2 (2h6p A:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719536Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (21 PDB entries)
  8. 719548Domain d2h6pa2: 2h6p A:1-181 [136202]
    Other proteins in same PDB: d2h6pa1, d2h6pb1
    automatically matched to d1a1ma2

Details for d2h6pa2

PDB Entry: 2h6p (more details), 1.9 Å

PDB Description: crystal structure of hla-b*3501 presenting the human cytochrome p450 derived peptide, kpivvlhgy
PDB Compounds: (A:) hla-b35

SCOP Domain Sequences for d2h6pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6pa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOP Domain Coordinates for d2h6pa2:

Click to download the PDB-style file with coordinates for d2h6pa2.
(The format of our PDB-style files is described here.)

Timeline for d2h6pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h6pa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2h6pb1