SCOP 1.73: Domain d2h6ma1: 2h6m A:1-212

Lineage for d2h6ma1 (2h6m A:1-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (3 species)

7. Species Human hepatitis A virus [TaxId:208726] [50606] (7 PDB entries)

8. Domain d2h6ma1: 2h6m A:1-212 [136200]
   automatically matched to d1hava_
   complexed with bbl, epq; mutant

Details for d2h6ma1

PDB Entry: 2h6m, 1.4 Å

PDB Description: an episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors

PDB Compounds: (A:) picornain 3c

SCOP Domain Sequences for d2h6ma1:

Sequence; same for both SEQRES and ATOM records:

>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqni

Timeline for d2h6ma1:

• d2h6ma1 is new in SCOP 1.73
  
• d2h6ma1 appears in SCOP 1.75
  
• d2h6ma1 appears in the current release, SCOPe 2.08, called d2h6ma_