Lineage for d2h6lc2 (2h6l C:1-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615725Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 2615726Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 2615739Family d.290.1.3: AF0104-like [143094] (3 proteins)
    Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4)
  6. 2615746Protein automated matches [190677] (2 species)
    not a true protein
  7. 2615747Species Archaeoglobus fulgidus [TaxId:2234] [187791] (1 PDB entry)
  8. 2615749Domain d2h6lc2: 2h6l C:1-138 [136199]
    Other proteins in same PDB: d2h6la1, d2h6la2, d2h6lb3, d2h6lc3
    automated match to d2h6la1
    complexed with acy, zn

Details for d2h6lc2

PDB Entry: 2h6l (more details), 2 Å

PDB Description: X-Ray Crystal Structure of the Metal-containing Protein AF0104 from Archaeoglobus fulgidus. Northeast Structural Genomics Consortium Target GR103.
PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2h6lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6lc2 d.290.1.3 (C:1-138) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
sgeaperafdeqtglflw

SCOPe Domain Coordinates for d2h6lc2:

Click to download the PDB-style file with coordinates for d2h6lc2.
(The format of our PDB-style files is described here.)

Timeline for d2h6lc2: