![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
![]() | Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) ![]() characteristic metal ion (zinc)-binding motif in the putative active site |
![]() | Family d.290.1.3: AF0104-like [143094] (3 proteins) Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4) |
![]() | Protein automated matches [190677] (2 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [187791] (1 PDB entry) |
![]() | Domain d2h6lb2: 2h6l B:1-138 [136198] Other proteins in same PDB: d2h6la1, d2h6la2, d2h6lb3, d2h6lc3 automated match to d2h6la1 complexed with acy, zn |
PDB Entry: 2h6l (more details), 2 Å
SCOPe Domain Sequences for d2h6lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h6lb2 d.290.1.3 (B:1-138) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl sgeaperafdeqtglflw
Timeline for d2h6lb2:
![]() Domains from other chains: (mouse over for more information) d2h6la1, d2h6la2, d2h6lc2, d2h6lc3 |