SCOPe 2.08: Domain d2h6la1: 2h6l A:1-138

Lineage for d2h6la1 (2h6l A:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
   duplication: consists of two similar beta-alpha-beta(4) motifs

4. Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families)
   characteristic metal ion (zinc)-binding motif in the putative active site

5. Family d.290.1.3: AF0104-like [143094] (3 proteins)
   Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4)

6. Protein Hypothetical protein AF0104 [143095] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [143096] (1 PDB entry)
   Uniprot O30132 1-138

8. Domain d2h6la1: 2h6l A:1-138 [136197]
   Other proteins in same PDB: d2h6la2, d2h6lb2, d2h6lb3, d2h6lc2, d2h6lc3
   complexed with acy, zn

Details for d2h6la1

PDB Entry: 2h6l, 2 Å

PDB Description: X-Ray Crystal Structure of the Metal-containing Protein AF0104 from Archaeoglobus fulgidus. Northeast Structural Genomics Consortium Target GR103.

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2h6la1:

Sequence; same for both SEQRES and ATOM records:

>d2h6la1 d.290.1.3 (A:1-138) Hypothetical protein AF0104 {Archaeoglobus fulgidus [TaxId: 2234]}
mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
sgeaperafdeqtglflw

Timeline for d2h6la1:

• d2h6la1 first appeared in SCOP 1.73
  
• d2h6la1 appears in SCOPe 2.07