Lineage for d2h6la1 (2h6l A:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009890Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 3009891Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 3009904Family d.290.1.3: AF0104-like [143094] (3 proteins)
    Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4)
  6. 3009905Protein Hypothetical protein AF0104 [143095] (1 species)
  7. 3009906Species Archaeoglobus fulgidus [TaxId:2234] [143096] (1 PDB entry)
    Uniprot O30132 1-138
  8. 3009907Domain d2h6la1: 2h6l A:1-138 [136197]
    Other proteins in same PDB: d2h6la2, d2h6lb2, d2h6lb3, d2h6lc2, d2h6lc3
    complexed with acy, zn

Details for d2h6la1

PDB Entry: 2h6l (more details), 2 Å

PDB Description: X-Ray Crystal Structure of the Metal-containing Protein AF0104 from Archaeoglobus fulgidus. Northeast Structural Genomics Consortium Target GR103.
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2h6la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6la1 d.290.1.3 (A:1-138) Hypothetical protein AF0104 {Archaeoglobus fulgidus [TaxId: 2234]}
mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekke
yvkkelmepleilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlpl
sgeaperafdeqtglflw

SCOPe Domain Coordinates for d2h6la1:

Click to download the PDB-style file with coordinates for d2h6la1.
(The format of our PDB-style files is described here.)

Timeline for d2h6la1: