Lineage for d2h6jg1 (2h6j G:9-235)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2597122Species Rhodococcus erythropolis [TaxId:1833] [103314] (3 PDB entries)
  8. 2597143Domain d2h6jg1: 2h6j G:9-235 [136196]
    Other proteins in same PDB: d2h6jh1, d2h6ji1, d2h6jj1, d2h6jk1, d2h6jl1, d2h6jm1, d2h6jn1
    automatically matched to d1q5qa_

Details for d2h6jg1

PDB Entry: 2h6j (more details), 3.2 Å

PDB Description: crystal structure of the beta f145a rhodococcus proteasome
PDB Compounds: (G:) proteasome alpha-type subunit 1

SCOPe Domain Sequences for d2h6jg1:

Sequence, based on SEQRES records: (download)

>d2h6jg1 d.153.1.4 (G:9-235) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpae

Sequence, based on observed residues (ATOM records): (download)

>d2h6jg1 d.153.1.4 (G:9-235) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggvdvaslevavldqsrprrafrriagtaleqlvpae

SCOPe Domain Coordinates for d2h6jg1:

Click to download the PDB-style file with coordinates for d2h6jg1.
(The format of our PDB-style files is described here.)

Timeline for d2h6jg1: