Lineage for d2h6fa1 (2h6f A:55-369)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647144Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 647145Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 647146Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 647147Species Human (Homo sapiens) [TaxId:9606] [69093] (20 PDB entries)
  8. 647148Domain d2h6fa1: 2h6f A:55-369 [136185]
    Other proteins in same PDB: d2h6fb1
    automatically matched to d1s63a_
    complexed with acy, far, suc, zn; mutant

Details for d2h6fa1

PDB Entry: 2h6f (more details), 1.5 Å

PDB Description: protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOP Domain Sequences for d2h6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhst

SCOP Domain Coordinates for d2h6fa1:

Click to download the PDB-style file with coordinates for d2h6fa1.
(The format of our PDB-style files is described here.)

Timeline for d2h6fa1: