Lineage for d2h6aa_ (2h6a A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231369Protein automated matches [190079] (9 species)
    not a true protein
  7. 2231506Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (7 PDB entries)
  8. 2231508Domain d2h6aa_: 2h6a A: [136183]
    automated match to d1smla_
    complexed with so4, zn

Details for d2h6aa_

PDB Entry: 2h6a (more details), 1.8 Å

PDB Description: Crystal structure of the zinc-beta-lactamase L1 from Stenotrophomonas maltophilia (mono zinc form)
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2h6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6aa_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d2h6aa_:

Click to download the PDB-style file with coordinates for d2h6aa_.
(The format of our PDB-style files is described here.)

Timeline for d2h6aa_: