| Class g: Small proteins [56992] (92 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
| Protein Type II activin receptor [57357] (3 species) |
| Species Mouse (Mus musculus), isoform IIB [TaxId:10090] [111406] (2 PDB entries) Uniprot P27040 23-120; 100% sequence identity to the rat domain of the same type IIb (90154) |
| Domain d2h64c_: 2h64 C: [136182] Other proteins in same PDB: d2h64a1, d2h64b_ automated match to d1nysa_ |
PDB Entry: 2h64 (more details), 1.92 Å
SCOPe Domain Sequences for d2h64c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h64c_ g.7.1.3 (C:) Type II activin receptor {Mouse (Mus musculus), isoform IIB [TaxId: 10090]}
aetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfn
cydrqecvateenpqvyfcccegnfcnerfthlp
Timeline for d2h64c_: