Lineage for d2h64c_ (2h64 C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962339Protein Type II activin receptor [57357] (3 species)
  7. 1962346Species Mouse (Mus musculus), isoform IIB [TaxId:10090] [111406] (2 PDB entries)
    Uniprot P27040 23-120; 100% sequence identity to the rat domain of the same type IIb (90154)
  8. 1962347Domain d2h64c_: 2h64 C: [136182]
    Other proteins in same PDB: d2h64a1, d2h64b_
    automated match to d1nysa_

Details for d2h64c_

PDB Entry: 2h64 (more details), 1.92 Å

PDB Description: crystal structure of a ternary ligand-receptor complex of bmp-2
PDB Compounds: (C:) Acvr2b protein

SCOPe Domain Sequences for d2h64c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h64c_ g.7.1.3 (C:) Type II activin receptor {Mouse (Mus musculus), isoform IIB [TaxId: 10090]}
aetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfn
cydrqecvateenpqvyfcccegnfcnerfthlp

SCOPe Domain Coordinates for d2h64c_:

Click to download the PDB-style file with coordinates for d2h64c_.
(The format of our PDB-style files is described here.)

Timeline for d2h64c_: