Class g: Small proteins [56992] (90 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (5 proteins) |
Protein BMP receptor Ia ectodomain [57359] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries) |
Domain d2h64b1: 2h64 B:34-118 [136181] Other proteins in same PDB: d2h64a1, d2h64c_ automatically matched to d1es7d_ |
PDB Entry: 2h64 (more details), 1.92 Å
SCOPe Domain Sequences for d2h64b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h64b1 g.7.1.3 (B:34-118) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka qlrrtieccrtnlcnqylqptlppv
Timeline for d2h64b1: