SCOPe 2.01: Domain d2h64b1: 2h64 B:34-118

Lineage for d2h64b1 (2h64 B:34-118)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)

8. Domain d2h64b1: 2h64 B:34-118 [136181]
   Other proteins in same PDB: d2h64a1, d2h64c_
   automatically matched to d1es7d_

Details for d2h64b1

PDB Entry: 2h64, 1.92 Å

PDB Description: crystal structure of a ternary ligand-receptor complex of bmp-2

PDB Compounds: (B:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2h64b1:

Sequence; same for both SEQRES and ATOM records:

>d2h64b1 g.7.1.3 (B:34-118) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv

Timeline for d2h64b1:

• d2h64b1 first appeared in SCOP 1.73
  
• d2h64b1 appears in SCOP 1.75
  
• d2h64b1 appears in SCOPe 2.02
  
• d2h64b1 appears in the current release, SCOPe 2.08, called d2h64b_