SCOPe 2.03: Domain d2h62d_: 2h62 D:

Lineage for d2h62d_ (2h62 D:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (5 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (6 PDB entries)

8. Domain d2h62d_: 2h62 D: [136180]
   Other proteins in same PDB: d2h62a_, d2h62b_
   automated match to d1nysa_

Details for d2h62d_

PDB Entry: 2h62, 1.85 Å

PDB Description: Crystal structure of a ternary ligand-receptor complex of BMP-2

PDB Compounds: (D:) Acvr2b protein

SCOPe Domain Sequences for d2h62d_:

Sequence; same for both SEQRES and ATOM records:

>d2h62d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
aetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfn
cydrqecvateenpqvyfcccegnfcnerfthl

Timeline for d2h62d_:

• d2h62d_ first appeared in SCOP 1.73, called d2h62d1
  
• d2h62d_ appears in SCOPe 2.02
  
• d2h62d_ appears in SCOPe 2.04
  
• d2h62d_ appears in the current release, SCOPe 2.08